PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv8_186270_jcpj.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family bZIP
Protein Properties Length: 208aa    MW: 23844.9 Da    PI: 6.0209
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv8_186270_jcpj.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.12.5e-1590152163
                         XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         e+e++r +r+++NRe+ArrsR+RK++++e+L+  v +L a N++L+++l+   +  ++  +e+
  Bv8_186270_jcpj.t1  90 EQEIRRLKRMISNRESARRSRLRKRKQLENLQSQVLQLLAANHQLAEKLNLVMESNYEILQEN 152
                         6899*************************************************9999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.2E-1184143No hitNo description
SMARTSM003384.5E-1490154IPR004827Basic-leucine zipper domain
PfamPF001701.3E-1390152IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.23192155IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.25E-1094146No hitNo description
CDDcd147028.34E-1795143No hitNo description
PROSITE patternPS00036097112IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MYQIDEDKGF HIPTPPLTIN QPNDTINPSQ FCIISPNHNK FLPNLHSYLP LHDLTSLNPT  60
LDTQSPSPNN SIINPIICSD DQANKEQSEE QEIRRLKRMI SNRESARRSR LRKRKQLENL  120
QSQVLQLLAA NHQLAEKLNL VMESNYEILQ ENSRLRDEAI CLRNQLLMSM KCDLGLEEDG  180
ACTIRPNQSV NSPNSITSSM EVLRQNCE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1106112RRSRLRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010686844.11e-149PREDICTED: G-box-binding factor 3-like
TrEMBLA0A0J8BW031e-149A0A0J8BW03_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.12e-09basic leucine-zipper 70